Protein Info for Dsui_3085 in Dechlorosoma suillum PS

Annotation: tetratricopeptide repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 signal peptide" amino acids 1 to 41 (41 residues), see Phobius details PF13432: TPR_16" amino acids 52 to 107 (56 residues), 25.2 bits, see alignment 1.2e-08 amino acids 115 to 167 (53 residues), 20.9 bits, see alignment 2.6e-07 PF14559: TPR_19" amino acids 87 to 141 (55 residues), 30.9 bits, see alignment 1.8e-10 PF07719: TPR_2" amino acids 110 to 141 (32 residues), 23.3 bits, see alignment (E = 3.1e-08) PF13181: TPR_8" amino acids 110 to 137 (28 residues), 16.6 bits, see alignment (E = 4.6e-06) PF13428: TPR_14" amino acids 112 to 151 (40 residues), 23.7 bits, see alignment 3.4e-08 PF13174: TPR_6" amino acids 115 to 141 (27 residues), 18.2 bits, see alignment (E = 2e-06) PF13414: TPR_11" amino acids 119 to 156 (38 residues), 28.2 bits, see alignment 7.8e-10 PF13474: SnoaL_3" amino acids 281 to 382 (102 residues), 29.9 bits, see alignment E=4.1e-10 PF24125: Cds6_C" amino acids 281 to 384 (104 residues), 63.4 bits, see alignment E=1.5e-20 PF14534: DUF4440" amino acids 282 to 380 (99 residues), 35.8 bits, see alignment E=6.3e-12

Best Hits

KEGG orthology group: None (inferred from 51% identity to aaa:Acav_2811)

Predicted SEED Role

"TPR repeat precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QI16 at UniProt or InterPro

Protein Sequence (387 amino acids)

>Dsui_3085 tetratricopeptide repeat protein (Dechlorosoma suillum PS)
MGSHFSPAARLPRHSSRSRLLPALLIGALIGLGSANISLAADVAITDIQKMVRQGQNAQA
LEKVDAYIATRPKDAQGRFLRGIILTELNRNNEAIAVFTKLTEDFPELPEPYNNLAVLYA
QQKQYDKARTALEMAIRTHPSYAVAHENLGDVYAKLASQAYDKALQLDSSNAHAQSKLSL
IREMIGSSRAPGGKVPAAAAPAAAPTPAPAPAPAAAPAPTPAPAPVPAAAAAKAPEAAKG
TPAKVTVLDKPEKEKPAAEPAKAEKPAPAAAKAEAADEGAVTKAVQNWAAAWSRKDVKGY
LSFYAPDFQAPGGNRKAWEKERASRIDKPGKLQVSVEDIKVSQNGDKATVRFKQNYTSAT
LKSSAAKTLVLQRSGGKWLIQQEKVGS