Protein Info for Dsui_3083 in Dechlorosoma suillum PS

Annotation: ABC-type branched-chain amino acid transport system, periplasmic component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF13458: Peripla_BP_6" amino acids 33 to 376 (344 residues), 229 bits, see alignment E=2e-71 PF01094: ANF_receptor" amino acids 61 to 335 (275 residues), 60.3 bits, see alignment E=2.7e-20

Best Hits

KEGG orthology group: None (inferred from 65% identity to dar:Daro_0920)

Predicted SEED Role

"Extracellular ligand-binding receptor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHM4 at UniProt or InterPro

Protein Sequence (381 amino acids)

>Dsui_3083 ABC-type branched-chain amino acid transport system, periplasmic component (Dechlorosoma suillum PS)
MKRFRHRLASLLMASCALLSGAAMAENGVTDSTITLGMSAPFSGPNGIYGTEMRESITAY
FEQINKGGGINGRKLELVSLDDGYETDRAVANTKKLIHDEKAFALLAFYGSSPTTAAMEV
FSGAKVPLVGTISGAETLRNPVNRYMFNVRASYANETDAIVSQLASLGLKNIAVFYQNDG
FGKSGLDGVTAALKKHGLAPSAVGTVERNSLDVAKAVEAISKVTPQAVIMVTLYKPTAEF
VRQMRKHGQNPQFMTLSPVGADLLVKELGNDARGIGISQVMPYPWNDSNPLVREYRKLMT
TMGKQSQSPYYGVEGYAMAKVMVEGIKRAGKDLTRDKLTTALESMGSYDLGGYRVSYSTS
DHNGSRFVDLTVIGNGGKVLR