Protein Info for Dsui_3074 in Dechlorosoma suillum PS

Annotation: heat shock gene repressor HrcA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 TIGR00331: heat-inducible transcription repressor HrcA" amino acids 3 to 335 (333 residues), 333.1 bits, see alignment E=1.3e-103 PF01628: HrcA" amino acids 103 to 322 (220 residues), 230.8 bits, see alignment E=9.2e-73

Best Hits

Swiss-Prot: 74% identical to HRCA_DECAR: Heat-inducible transcription repressor HrcA (hrcA) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K03705, heat-inducible transcriptional repressor (inferred from 74% identity to dar:Daro_0930)

Predicted SEED Role

"Heat-inducible transcription repressor HrcA" in subsystem Heat shock dnaK gene cluster extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHL5 at UniProt or InterPro

Protein Sequence (342 amino acids)

>Dsui_3074 heat shock gene repressor HrcA (Dechlorosoma suillum PS)
MLDNRARILLKTLVERYIAEGQPVGSRALSRFSGLDLSPATIRNVMADLEEQGFIASPHT
SAGRIPTPRGYRLFVDSLLAVQPLQENQIHEMEGQLIQTQPQQLIGNASHLLSELTQFAG
IVVTPRRKTPTIRQIEFLGLSEKRILLIIVTTDGDVQNRILLTERPYSPSELTTAANYLN
HNYAGLDFDQIRQCLTGEIQQLQDDLKILMASALEAGNQALNDSASQYVISGEKNLLEVE
ELSSNMKRLRELFDLFEQKTGLVRLLDISNNADGVQIYIGGESGLAPLDECSVVTAPYEV
NGQVVGSVGVIGPTRMAYERVIPIVDITAKLLSSALTYQANT