Protein Info for Dsui_3065 in Dechlorosoma suillum PS

Annotation: carbamoyl-phosphate synthase, small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR01368: carbamoyl-phosphate synthase, small subunit" amino acids 10 to 375 (366 residues), 493.4 bits, see alignment E=1.8e-152 PF00988: CPSase_sm_chain" amino acids 12 to 137 (126 residues), 179 bits, see alignment E=5.1e-57 PF00117: GATase" amino acids 196 to 372 (177 residues), 182 bits, see alignment E=1.5e-57 PF07722: Peptidase_C26" amino acids 249 to 285 (37 residues), 20.5 bits, see alignment 5.3e-08

Best Hits

Swiss-Prot: 76% identical to CARA_THISH: Carbamoyl-phosphate synthase small chain (carA) from Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)

KEGG orthology group: K01956, carbamoyl-phosphate synthase small subunit [EC: 6.3.5.5] (inferred from 80% identity to app:CAP2UW1_3741)

MetaCyc: 68% identical to carbamoyl-phosphate synthetase small subunit (Escherichia coli K-12 substr. MG1655)
Carbamoyl-phosphate synthase (glutamine-hydrolyzing). [EC: 6.3.5.5]

Predicted SEED Role

"Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)" in subsystem De Novo Pyrimidine Synthesis or Macromolecular synthesis operon (EC 6.3.5.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.5

Use Curated BLAST to search for 6.3.5.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHK6 at UniProt or InterPro

Protein Sequence (382 amino acids)

>Dsui_3065 carbamoyl-phosphate synthase, small subunit (Dechlorosoma suillum PS)
MSLLPAFSPALLALADGTVFRGYAIGAEGTTSGEVVFNTAMTGYQEILTDPSYCRQIVTL
TYPHIGNTGCNAEDFESRANFAAGLVIRDLPIRASNWRIEQTLPDYLKQHGVVAIAGIDT
RKLTRILREKGAQAGCIIAGVADEAKALAEARAFPGLAGMDLAKVVSVDSPYQFSEGEWT
LKGYAAAPAAKFKVVAYDYGVKTNILRMLAARGCDVTVVPAQTPAAEVLKYKPDGVFLSN
GPGDPEPCDYAITAIREILAAGVPTYGICLGHQLLALASGAKTLKMKFGHHGANHPVKDL
DTNQVLITSQNHGFAVDADTLPANVRATHVSLFDGSLQGIARTDVPAFSFQGHPEASPGP
HDVAYLFDRFIKLMQDKKAEGK