Protein Info for Dsui_3049 in Dechlorosoma suillum PS

Annotation: NADH-quinone oxidoreductase, B subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 transmembrane" amino acids 29 to 45 (17 residues), see Phobius details TIGR01957: NADH-quinone oxidoreductase, B subunit" amino acids 11 to 152 (142 residues), 257.5 bits, see alignment E=1.5e-81 PF01058: Oxidored_q6" amino acids 37 to 146 (110 residues), 99.4 bits, see alignment E=6.5e-33

Best Hits

Swiss-Prot: 96% identical to NUOB_DECAR: NADH-quinone oxidoreductase subunit B (nuoB) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K00331, NADH dehydrogenase I subunit B [EC: 1.6.5.3] (inferred from 94% identity to app:CAP2UW1_3780)

MetaCyc: 62% identical to ferredoxin-menaquinone dehydrogenase subunit B (Helicobacter pylori 26695)
7.1.1.-

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain B (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHJ1 at UniProt or InterPro

Protein Sequence (158 amino acids)

>Dsui_3049 NADH-quinone oxidoreductase, B subunit (Dechlorosoma suillum PS)
MAIEGILQEGFVTTTADKLINYMRTGSLWPMTFGLACCAVEMIHAGCSRYDLDRFGIVFR
PSPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCD
RIVPVDIYVPGCPPTAEALLYGLVQLQNKIRRTNTIAR