Protein Info for Dsui_3048 in Dechlorosoma suillum PS

Annotation: NADH/F420H2 dehydrogenase, subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 TIGR01961: NADH (or F420H2) dehydrogenase, subunit C" amino acids 30 to 158 (129 residues), 130.7 bits, see alignment E=2.1e-42 PF00329: Complex1_30kDa" amino acids 31 to 160 (130 residues), 147.3 bits, see alignment E=1.6e-47

Best Hits

Swiss-Prot: 77% identical to NUOC_DECAR: NADH-quinone oxidoreductase subunit C (nuoC) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K00332, NADH dehydrogenase I subunit C [EC: 1.6.5.3] (inferred from 77% identity to dar:Daro_0951)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain C (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHJ0 at UniProt or InterPro

Protein Sequence (197 amino acids)

>Dsui_3048 NADH/F420H2 dehydrogenase, subunit C (Dechlorosoma suillum PS)
MSKLETLGQSLQAQFGERLKSLKLALGEATIEVDAADYLQVMQELRDSEALCFDELIDLC
GVDYSTYGNDGWSGKRYAVVVHLLSVAKNWRLRVRVFAPDYAFPAVDSVVNVWSSANWFE
REAFDLFGIVFPGHEDLRRILTDYGFIGHPFRKDFPISGYVEMRYDPDQGRVIYQPVTIE
PRENTPRIVREENYGDV