Protein Info for Dsui_3047 in Dechlorosoma suillum PS

Annotation: NADH dehydrogenase I, D subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 87% identical to NUOD_DECAR: NADH-quinone oxidoreductase subunit D (nuoD) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K00333, NADH dehydrogenase I subunit D [EC: 1.6.5.3] (inferred from 87% identity to dar:Daro_0952)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain D (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

NADH to cytochrome bd oxidase electron transfer I (2/2 steps found)
aerobic respiration I (cytochrome c) (3/4 steps found)
aerobic respiration III (alternative oxidase pathway) (2/3 steps found)
NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
NAD(P)/NADPH interconversion (3/6 steps found)
Fe(II) oxidation (2/6 steps found)

KEGG Metabolic Maps

Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHI9 at UniProt or InterPro

Protein Sequence (417 amino acids)

>Dsui_3047 NADH dehydrogenase I, D subunit (Dechlorosoma suillum PS)
MAEIRNYTMNFGPQHPAAHGVLRLVLELDGEVVQRADPHIGLLHRATEKLAETRTWIQSV
PYMDRLDYVSMMSNEHAYCLAVEKLLGIEVPVRAQYIRVMFDEITRLLNHLLWIGCHGLD
VGAMAMVLYTFREREDLVDAYEAVSGARMHAAYYRPGGVYRDLPDRMPQYTENRFKSAST
VKTLNENRTGSLLDFLEDFTNRFPTYLDEYHTLLTDNRIWKQRLVNVGVVSPERALQLGF
TGAMLRGSGIAWDLRKKQPYEVYADLDFDIPVGVNGDSYDRYLVRMEEMRQSNRIIKQCI
DWLRKNPGPVITDNHKVAPPAREGMKSNMEELIHHFKLFTEGIHVPEGEAYAAVEHPKGE
FGIYFVSDGANKPYRMKIRAPGYAHLAAMDEMARGHMIADVVTIIGSQDIVFGEIDR