Protein Info for Dsui_3041 in Dechlorosoma suillum PS

Annotation: NADH:ubiquinone oxidoreductase subunit 6 (chain J)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 31 to 49 (19 residues), see Phobius details amino acids 55 to 77 (23 residues), see Phobius details amino acids 89 to 111 (23 residues), see Phobius details amino acids 143 to 164 (22 residues), see Phobius details PF00499: Oxidored_q3" amino acids 19 to 164 (146 residues), 148.9 bits, see alignment E=4.3e-48

Best Hits

KEGG orthology group: K00339, NADH dehydrogenase I subunit J [EC: 1.6.5.3] (inferred from 77% identity to dar:Daro_0958)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain J (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHI3 at UniProt or InterPro

Protein Sequence (200 amino acids)

>Dsui_3041 NADH:ubiquinone oxidoreductase subunit 6 (chain J) (Dechlorosoma suillum PS)
MEFKTVVFYFLSAILVYAALRVITARNPVHAALHLVLSFFSAGGVWALLQAEFLAISIVL
VYVGAVMVLFLFVVMMLDINIDRIREGFWNYLPLGAVVGLLMVVEMGAILGSQYLGAAEA
QVPQTAAGVSNVKELGRLLFTEYVYPFELASVILLVALIAAIVLTHRGAKKTKYTDPAKQ
VFVKAADRIRVLQMPAEKQD