Protein Info for Dsui_3036 in Dechlorosoma suillum PS

Annotation: Zn-finger containing NTP pyrophosphohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 189 PF28549: NDPSase_N" amino acids 13 to 47 (35 residues), 32.9 bits, see alignment 4.2e-12 PF00293: NUDIX" amino acids 51 to 172 (122 residues), 63.1 bits, see alignment E=2.8e-21

Best Hits

Swiss-Prot: 38% identical to ACT_BACMT: Methanol dehydrogenase activator (act) from Bacillus methanolicus

KEGG orthology group: K01515, ADP-ribose pyrophosphatase [EC: 3.6.1.13] (inferred from 67% identity to app:CAP2UW1_3767)

Predicted SEED Role

"ADP-ribose pyrophosphatase (EC 3.6.1.13)" in subsystem NAD and NADP cofactor biosynthesis global or Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.13)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHH8 at UniProt or InterPro

Protein Sequence (189 amino acids)

>Dsui_3036 Zn-finger containing NTP pyrophosphohydrolase (Dechlorosoma suillum PS)
MERQTKPDAHLVEETLSTEQVWRGRLLDVRRDQVRLPDAHEGVREYIVHPGAVVIIAVLD
NGKLLFERQYRHPVGQVFLELPAGKIDPGEEILKTAIRELREETGHAAGQWRYLGVMHPC
IGYSNERIEIFLARELTRESAPQLDHGEHLEVIEMSLEEAAAAIRDGRLTDAKTITALYW
AEKVLQEGW