Protein Info for Dsui_3035 in Dechlorosoma suillum PS

Annotation: diguanylate cyclase (GGDEF) domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 transmembrane" amino acids 51 to 72 (22 residues), see Phobius details amino acids 78 to 99 (22 residues), see Phobius details amino acids 111 to 130 (20 residues), see Phobius details amino acids 138 to 160 (23 residues), see Phobius details amino acids 168 to 188 (21 residues), see Phobius details amino acids 196 to 222 (27 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 224 to 383 (160 residues), 151.9 bits, see alignment E=6.6e-49 PF00990: GGDEF" amino acids 226 to 380 (155 residues), 139.4 bits, see alignment E=4.6e-45

Best Hits

KEGG orthology group: None (inferred from 66% identity to eba:ebA784)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHH7 at UniProt or InterPro

Protein Sequence (387 amino acids)

>Dsui_3035 diguanylate cyclase (GGDEF) domain-containing protein (Dechlorosoma suillum PS)
MTSRLAHIVWHRLTGLMPGELNQAELAWLVSPHFHLTLLSRRRATMIVNRVRLFAFLFAV
LTPLWSIIDYLVFPFPLWFALASMRILASVAFALLVLYYRPSGSLTDAYRAMAILFAIPT
VFYVATHQLLVNYQLTGMQAAIGAGYAFLPFVLLAGLSIFPLTLLENILFALPMLLAQAV
SGIISWATLDWPSFAGAFWLLTLITGVSTLAGLSQLAFMIALVRQAVRDPLTGIFSRRSG
EEVLELQFIISTRSNAPLAIAFLDLDNFKAVNDRYGHEAGDSVLVGATDSISNNLRRGDM
LARWGGEEFILIMPNTDLEQAQQAMRRMRQAGFGLRPDGSPVTASIGIAERLEDQTLDWK
TLVEKADQRMYRAKQSGRDRVVCDDTV