Protein Info for Dsui_3029 in Dechlorosoma suillum PS

Annotation: NADH:ubiquinone oxidoreductase chain G-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 PF13510: Fer2_4" amino acids 6 to 77 (72 residues), 63.2 bits, see alignment E=5e-21 PF00111: Fer2" amino acids 10 to 68 (59 residues), 33.7 bits, see alignment E=7e-12 PF10588: NADH-G_4Fe-4S_3" amino acids 84 to 119 (36 residues), 49.9 bits, see alignment 4.5e-17 PF22117: Fer4_Nqo3" amino acids 139 to 206 (68 residues), 32.5 bits, see alignment E=2.1e-11 PF13459: Fer4_15" amino acids 140 to 206 (67 residues), 39.7 bits, see alignment E=1.6e-13

Best Hits

KEGG orthology group: K00436, hydrogen dehydrogenase [EC: 1.12.1.2] (inferred from 82% identity to azo:azo1413)

Predicted SEED Role

"NAD-reducing hydrogenase subunit HoxU (EC 1.12.1.2)" in subsystem Hydrogenases (EC 1.12.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.12.1.2

Use Curated BLAST to search for 1.12.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHH1 at UniProt or InterPro

Protein Sequence (237 amino acids)

>Dsui_3029 NADH:ubiquinone oxidoreductase chain G-like protein (Dechlorosoma suillum PS)
MSDTKKFLLDGKPVVFQDGQTILEAARQAGHYIPHLCWHPDFPAHGSCKLCIVKVGGRHV
SSCAMPAKEGMEVESNTPEMNGERRALLQMLFVEGNHFCPSCEKSGNCQLQALAYDLEML
SAHFNHFYPNRPVDASHPDVLLDFNRCIFCELCVRASRDIDGKNIFALTDRGIHKHLVVN
AESGRLADTDFAASDRAANICPVGVILHKRQGFARPIGERDYDAKPISVVAMEEVEK