Protein Info for Dsui_3028 in Dechlorosoma suillum PS

Annotation: coenzyme F420-reducing hydrogenase, gamma subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01058: Oxidored_q6
  • amino acids 18 to 168 (151 residues), 104.1 bits, E=2.3e-34

Best Hits

Swiss-Prot: 50% identical to HOXY_CUPNH: NAD-reducing hydrogenase HoxS subunit delta (hoxY) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K00436, hydrogen dehydrogenase [EC: 1.12.1.2] (inferred from 81% identity to app:CAP2UW1_0999)

MetaCyc: 50% identical to delta subunit (Cupriavidus necator)

Predicted SEED Role

"NAD-reducing hydrogenase subunit HoxY (EC 1.12.1.2)" in subsystem Hydrogenases (EC 1.12.1.2)

MetaCyc Pathways

• hydrogen oxidation II (aerobic, NAD) (1/1 steps found)
• hydrogen production II (1/1 steps found)
• superpathway of hydrogen production (1/2 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Methane metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.12.1.2

Use Curated BLAST to search for 1.12.1.2

Sequence Analysis Tools

See G8QHH0 at UniProt or InterPro

Protein Sequence (185 amino acids)

>Dsui_3028 coenzyme F420-reducing hydrogenase, gamma subunit (Dechlorosoma suillum PS)
MIVSGRKLRVATTSLAGCFGCHMSFLDIDEHLLELVELVEFDRSPLTDIKHCGPCDIGII
EGGVCNAENVHVLREFRKHCKILIALGACAVTGGLPAQRNHLDVGQCLQEVYHTCIGVES
LPGGQVPNDPELPLLLDKVHPIHEVVRVDYFIPGCPPSGEAIWKFLTDLIAGHTPRLSHP
ILRFD