Protein Info for Dsui_3012 in Dechlorosoma suillum PS

Annotation: hydrogenase (NiFe) small subunit HydA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 transmembrane" amino acids 344 to 366 (23 residues), see Phobius details TIGR00391: hydrogenase (NiFe) small subunit (hydA)" amino acids 12 to 370 (359 residues), 465.1 bits, see alignment E=8.5e-144 PF01058: Oxidored_q6" amino acids 70 to 214 (145 residues), 108.6 bits, see alignment E=1.8e-35 PF14720: NiFe_hyd_SSU_C" amino acids 234 to 313 (80 residues), 92 bits, see alignment E=2.5e-30

Best Hits

Swiss-Prot: 54% identical to MBHT_ECOL6: Hydrogenase-2 small chain (hybO) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K06282, hydrogenase small subunit [EC: 1.12.99.6] (inferred from 81% identity to dar:Daro_3974)

MetaCyc: 54% identical to hydrogenase 2 small subunit (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Uptake hydrogenase small subunit precursor (EC 1.12.99.6)" in subsystem Hydrogenases or Membrane-bound Ni, Fe-hydrogenase (EC 1.12.99.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.12.99.6

Use Curated BLAST to search for 1.12.99.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHF4 at UniProt or InterPro

Protein Sequence (393 amino acids)

>Dsui_3012 hydrogenase (NiFe) small subunit HydA (Dechlorosoma suillum PS)
MQEQKLQSLEIHEHVIEAAKRLEMGRREFLQFCTAMAATLGLPAGAEAAVAEAVAVKKRP
SVIWLHFQECTGCTESMLRAEHPTIEKLILDVISLDYHETLFAAAGHQIEAAKQAAMKAN
KGQYLLVVEGAIPTKDGGIYCKVGGKTAIDIVKECATDAAAIIAIGSCASWGGMPSTDPN
PTGAVGVNKIIDKPVVTIPGCPPNPYNFLSTVVHFLTFGQLPPVDELGRPKFAYSRLVHE
NCERRAHFDAGRFAMEFGDEGHRKGYCLYKLGCKGPETYANCPTILFGDAGAGTWPVACG
HPCIGCTEQGVGFQKPIHQTAKVMTYAPPASFPRIVEEQGKGASLGAAAVLAAVAGAAAG
AGAMVAKNLGLSHAAEEAEKAKQSSEQKPAEKV