Protein Info for Dsui_3002 in Dechlorosoma suillum PS

Annotation: PAS domain S-box

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 849 transmembrane" amino acids 24 to 44 (21 residues), see Phobius details amino acids 304 to 324 (21 residues), see Phobius details PF22588: dCache_1_like" amino acids 204 to 290 (87 residues), 35.9 bits, see alignment E=2.9e-12 TIGR00229: PAS domain S-box protein" amino acids 341 to 460 (120 residues), 35.4 bits, see alignment E=5.2e-13 amino acids 462 to 588 (127 residues), 50 bits, see alignment E=1.6e-17 PF13188: PAS_8" amino acids 345 to 393 (49 residues), 22.4 bits, see alignment 3.5e-08 PF00989: PAS" amino acids 345 to 451 (107 residues), 35.2 bits, see alignment E=4.5e-12 amino acids 484 to 569 (86 residues), 29.4 bits, see alignment E=2.9e-10 PF08448: PAS_4" amino acids 350 to 456 (107 residues), 41.4 bits, see alignment E=6.2e-14 amino acids 483 to 582 (100 residues), 25.2 bits, see alignment E=6.6e-09 PF13426: PAS_9" amino acids 363 to 452 (90 residues), 19.8 bits, see alignment E=3.3e-07 amino acids 485 to 580 (96 residues), 25.9 bits, see alignment E=3.9e-09 PF08447: PAS_3" amino acids 488 to 568 (81 residues), 56.5 bits, see alignment E=1.1e-18 PF02518: HATPase_c" amino acids 736 to 840 (105 residues), 63.1 bits, see alignment E=1.3e-20

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QH04 at UniProt or InterPro

Protein Sequence (849 amino acids)

>Dsui_3002 PAS domain S-box (Dechlorosoma suillum PS)
MAERNHAPYVDITKTAMKFRHSRLPLMAGLSGLLGFFILVGVSLKSDYDGLEERARVEVG
NLGHLMELHTAARIRNIDQILQDVQGHVTPEDMARSQAQRGARGEELERLLRTKREIVPE
VHGLHLVNVKGDFLYSSLSPLPPYNMADRSHFTAHVQNPEAGLVIAEPVLGRTTGKWTLA
VSRRLNNADGSFAGVVVATFLPESFAPFYQSLDLGPHGNVSIRDTHARMLMRFPARDDRI
GQPVESHPAQPYMARGDREILMKIRSGTDQVERLVSIRKVGEYPLYVFAGMAPEDYLSNW
RSKLYYYSAGSLLLAAVVLGLLVINRRGERQEESARRALAETEGRYRLLLENLPVGVIHF
DSRLCLTFCNERFATMVGSTVQALQGLDLQRLRDQSVLPAMRQALAGEGGTYDGSYRTTL
SHIDVWISFRANPLRDASGAIIGGIGIVEDVGEKRRAEDSLRQSERNFRTMADFTYDWEY
WQGADGRIVYMTPSVERITGYGVQAFADDPSLLQQIVHPDDRQEFQEHLNQAVFHHEHMV
DFRIVRRDGQVRWIAHGCQAVVGEEGEALGRRVSNRDVTERKTLEAELQALNSRLEARVQ
EELASNREKDQLLIQQSRLAAMGEMVHNIAHQWRQPLNALGLVIANIRDDFAFGQLDAAA
LDESVGRALKLLQRMSTTIDDFRNFFRPDRDPADFDLGAAVEDAAFIMEASLKNNDIALE
RAIEPDLRAWGFHGQFSQAVLNVLANAKEVLQERHVRPARIRLQVSRCDGQVEVTVEDNA
GGIPGNVLGHIFEPYFTTKEQGSGIGLYMTKMILERSMHGKIRAENTAEGARFVLTVPLY
TLPPTAPMQ