Protein Info for Dsui_2999 in Dechlorosoma suillum PS

Annotation: histidine kinase,HAMP domain-containing protein,histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 476 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 144 to 165 (22 residues), see Phobius details PF00672: HAMP" amino acids 167 to 213 (47 residues), 50.1 bits, see alignment 4.3e-17 PF00512: HisKA" amino acids 253 to 321 (69 residues), 33.7 bits, see alignment E=4.5e-12 PF02518: HATPase_c" amino acids 365 to 471 (107 residues), 73.8 bits, see alignment E=2.3e-24

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QH01 at UniProt or InterPro

Protein Sequence (476 amino acids)

>Dsui_2999 histidine kinase,HAMP domain-containing protein,histidine kinase (Dechlorosoma suillum PS)
MTLRLKLLLPLALVWTAFIAYLYGIWLPDSVRYQIAVFERQQEREMHNLTESLLPLVVAR
QLGDIHDTLDSLRQENPEWVEVVLQDHEGRQLYPLAGTPVPPAGPDEQLHTQQLNLANDS
VGSLRIRISHRALLESVAQSQKTLFALLASVLLGAFLALGVVLDATVRRPVNRLMTAARE
LAEGRFDAHLPPGGKDEIGTLVNTFAAMRDQVQATQQSLRQLNEHLEQRVQEELAKNREK
DHMLIQQSRLAAMGEMVHNIAHQWRQPLNALSLLVRNIKDDYDFQALTPEVMDRSVADAQ
RLLGRMSTTIDDFRDFFRPEKEMTQFDVSHAVEEAVFIMQGTLKSHGIELVEKLDPGVEA
EGFPSQFAQAVLNILANAKEEILARKVAAGRIEIELQRQGETILLRVSDNAGGIAPEILP
KIFDPYFTTKDKGSGIGLYMAKTIIEHNMNGSISAANLGDGACFTLTVPVRQPKKN