Protein Info for Dsui_2996 in Dechlorosoma suillum PS

Annotation: type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 604 PF05157: MshEN" amino acids 90 to 176 (87 residues), 48 bits, see alignment E=1e-16 PF00437: T2SSE" amino acids 210 to 595 (386 residues), 436.7 bits, see alignment E=5.8e-135

Best Hits

KEGG orthology group: K02454, general secretion pathway protein E (inferred from 78% identity to dar:Daro_1151)

Predicted SEED Role

"Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGZ8 at UniProt or InterPro

Protein Sequence (604 amino acids)

>Dsui_2996 type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB (Dechlorosoma suillum PS)
MPASTSASATSAKATVAEHRLTLGELVKLLVEDGMVDAVVADGLVKERRYHRGDVHPLVV
IADQNWKSLVPPHKPLILETLTEWLAAKVGLDYLHIDPLKIDFSAVTEVVSNTYAGRFKI
LPIQVTTREVIIATAEPFLREWEKELKPILRKDIRRVVANPQDIARYLVEFYNLARSVKK
AAAGGGEVSGLSSFEQLVELGKTNRQFDANDQHIVHIVDWLWQYAFEQRASDIHIEPRRE
LGIVRFRIDGVLHQVYQIPMAVMAAMTSRIKLLGRMDVIEKRRPQDGRIKTRTAGGQEVE
LRLSTLPTAFGEKLVMRIFDPEVLVRDFAELGFGEEDKSRWQFMTSQPNGIILVTGPTGS
GKTTTLYSTLKQLATPEVNVCTIEDPIEMVEQSFNQMQVSQNIDLGFADGVRALMRQDPD
IIMIGEIRDGETADMAIQAALTGHLVLSTLHTNDAPSAISRLLDLGMAPYLINATMLGVM
AQRLVRTLCPHCKKPVDLRREDEEIWDSLVAPWKSKRPAQIYQPVGCLECRMTGYMGRMG
LYELLLMSPEVKKLVTTTTDVAKVREQAYREGMKPLRISGAMKVAAGLTTLEEVIKVAPP
ASQG