Protein Info for Dsui_2983 in Dechlorosoma suillum PS

Annotation: electron transport complex, RnfABCDGE type, G subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details TIGR01947: electron transport complex, RnfABCDGE type, G subunit" amino acids 18 to 207 (190 residues), 178.3 bits, see alignment E=8.7e-57 PF04205: FMN_bind" amino acids 109 to 203 (95 residues), 67.1 bits, see alignment E=8.3e-23

Best Hits

Swiss-Prot: 45% identical to RNFG_PSEMY: Ion-translocating oxidoreductase complex subunit G (rnfG) from Pseudomonas mendocina (strain ymp)

KEGG orthology group: K03612, electron transport complex protein RnfG (inferred from 69% identity to app:CAP2UW1_2955)

Predicted SEED Role

"Electron transport complex protein RnfG" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGY6 at UniProt or InterPro

Protein Sequence (225 amino acids)

>Dsui_2983 electron transport complex, RnfABCDGE type, G subunit (Dechlorosoma suillum PS)
MVTVKEPTAGTMAARTAVILFVFVIVFTGLLAGAYQWTLPAIQASATEEKMKLVNEVLPT
ASYDNDLLHDTLALAPTPELGLEEPSTVFRARMGGAPAALVLEAVAPDGYAGKIRLILAV
QADGRVAGVRVTQHKETPGLGDYVEPKKDRNKERPWITQFNGLSLATLAEKEWKVKKDGG
HFDSNAGATVTPRAVVKAVKKAVAYVDAHRDELFAAADKNAADRK