Protein Info for Dsui_2982 in Dechlorosoma suillum PS

Annotation: electron transport complex, RnfABCDGE type, D subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 transmembrane" amino acids 22 to 55 (34 residues), see Phobius details amino acids 67 to 87 (21 residues), see Phobius details amino acids 93 to 111 (19 residues), see Phobius details amino acids 120 to 140 (21 residues), see Phobius details amino acids 191 to 212 (22 residues), see Phobius details amino acids 220 to 239 (20 residues), see Phobius details amino acids 245 to 265 (21 residues), see Phobius details amino acids 277 to 295 (19 residues), see Phobius details amino acids 301 to 319 (19 residues), see Phobius details PF03116: NQR2_RnfD_RnfE" amino acids 4 to 325 (322 residues), 357.9 bits, see alignment E=2.6e-111 TIGR01946: electron transport complex, RnfABCDGE type, D subunit" amino acids 6 to 325 (320 residues), 382.3 bits, see alignment E=1.1e-118

Best Hits

Swiss-Prot: 50% identical to RNFD_PSEMY: Ion-translocating oxidoreductase complex subunit D (rnfD) from Pseudomonas mendocina (strain ymp)

KEGG orthology group: K03614, electron transport complex protein RnfD (inferred from 68% identity to dar:Daro_1160)

Predicted SEED Role

"Electron transport complex protein RnfD" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGY5 at UniProt or InterPro

Protein Sequence (329 amino acids)

>Dsui_2982 electron transport complex, RnfABCDGE type, D subunit (Dechlorosoma suillum PS)
MEFSTSPYLLKDTSVRRVMTQVLLALVPGIVAYALLIGPGILAQIAIATLTALAAEAAML
RLRDKPLALFLGDGSAVVTAWLVALTFPPVAPWWLTVVGVLFAIVVAKHLYGGLGQNPFN
PAMIAFAVCIVSFPALMSQWPGPGSHLAPAQQLDWIFGLAPRLDGMTSATPLDALKTALR
ADEGHSGPLPFLAGNAQAVIALCYLAGGLFLVWRKVITWHIPTAFLGAMGLLAGLLWLWQ
PAGFANPVFHLLGGGAMLGAFFIATDPVSGATTPRGKLIFAAGVGLLAYIIRVFGGYPDG
IAFAVLIMNICVPLIDMYTQPKVFGMKDQ