Protein Info for Dsui_2980 in Dechlorosoma suillum PS

Annotation: electron transport complex, RnfABCDGE type, B subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 180 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR01944: electron transport complex, RnfABCDGE type, B subunit" amino acids 2 to 177 (176 residues), 258.8 bits, see alignment E=1.2e-81 PF04060: FeS" amino acids 41 to 73 (33 residues), 60.3 bits, see alignment 3.5e-20 PF12837: Fer4_6" amino acids 102 to 125 (24 residues), 26.3 bits, see alignment (E = 1.6e-09) PF14697: Fer4_21" amino acids 103 to 157 (55 residues), 69.6 bits, see alignment E=6.2e-23 PF12797: Fer4_2" amino acids 104 to 122 (19 residues), 25.2 bits, see alignment (E = 3.3e-09) PF00037: Fer4" amino acids 105 to 125 (21 residues), 31.2 bits, see alignment (E = 4e-11) amino acids 134 to 156 (23 residues), 21.3 bits, see alignment (E = 5.5e-08)

Best Hits

Swiss-Prot: 76% identical to RNFB_AZOSB: Ion-translocating oxidoreductase complex subunit B (rnfB) from Azoarcus sp. (strain BH72)

KEGG orthology group: K03616, electron transport complex protein RnfB (inferred from 79% identity to app:CAP2UW1_2958)

Predicted SEED Role

"Electron transport complex protein RnfB" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGY3 at UniProt or InterPro

Protein Sequence (180 amino acids)

>Dsui_2980 electron transport complex, RnfABCDGE type, B subunit (Dechlorosoma suillum PS)
MLIAIAIMALGAVVLGAALGFASVKFKVDGDPLVDKIEAILPQTQCGQCGYPGCKPYAEA
IAKGEADINLCPPGGAEGVGKLADLLGREAKPLDGVEKPPQVALIDENTCIGCTLCIQAC
PVDAIVGAAKQMHTIVESLCTGCELCLPPCPVECITMEPIQETVDTWKWKYPVVELKRVA