Protein Info for Dsui_2979 in Dechlorosoma suillum PS

Annotation: electron transport complex, RnfABCDGE type, A subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 39 to 60 (22 residues), see Phobius details amino acids 72 to 92 (21 residues), see Phobius details amino acids 104 to 123 (20 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details TIGR01943: electron transport complex, RnfABCDGE type, A subunit" amino acids 4 to 191 (188 residues), 278.6 bits, see alignment E=2e-87 PF02508: Rnf-Nqr" amino acids 7 to 191 (185 residues), 196.7 bits, see alignment E=1.6e-62

Best Hits

Swiss-Prot: 68% identical to RNFA_ALISL: Ion-translocating oxidoreductase complex subunit A (rnfA) from Aliivibrio salmonicida (strain LFI1238)

KEGG orthology group: K03617, electron transport complex protein RnfA (inferred from 91% identity to app:CAP2UW1_2959)

MetaCyc: 57% identical to Rnf complex RnfA subunit (Acetobacterium woodii)
TRANS-RXN-276 [EC: 7.2.1.2]

Predicted SEED Role

"Electron transport complex protein RnfA" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGY2 at UniProt or InterPro

Protein Sequence (195 amino acids)

>Dsui_2979 electron transport complex, RnfABCDGE type, A subunit (Dechlorosoma suillum PS)
MISHYLFIVIGAVLVNNVVLVKILGLCPFMGVSKKLETAFGMGAATTFVLTVATGASYII
DHYLLMPFGLEYLRTLSFIVTIAAIVQLTEMVIQKTSPVLHQVLGIYLPLITTNCAVLGV
PLLNVANHYDFVESLLFGMGSAVGFSLVLVLFAGIRERIEGADVPIHFRGVAIAMVTAGL
MSLAFMGFSGLDKYQ