Protein Info for Dsui_2972 in Dechlorosoma suillum PS

Annotation: leucyl/phenylalanyl-tRNA--protein transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 TIGR00667: leucyl/phenylalanyl-tRNA--protein transferase" amino acids 33 to 217 (185 residues), 203.9 bits, see alignment E=8.2e-65 PF03588: Leu_Phe_trans" amino acids 33 to 204 (172 residues), 258.8 bits, see alignment E=1.8e-81 PF13480: Acetyltransf_6" amino acids 74 to 171 (98 residues), 25.2 bits, see alignment E=1.5e-09

Best Hits

Swiss-Prot: 64% identical to LFTR_AROAE: Leucyl/phenylalanyl-tRNA--protein transferase (aat) from Aromatoleum aromaticum (strain EbN1)

KEGG orthology group: K00684, leucyl/phenylalanyl-tRNA--protein transferase [EC: 2.3.2.6] (inferred from 69% identity to app:CAP2UW1_1928)

Predicted SEED Role

"Leucyl/phenylalanyl-tRNA--protein transferase (EC 2.3.2.6)" in subsystem Protein degradation (EC 2.3.2.6)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGX5 at UniProt or InterPro

Protein Sequence (238 amino acids)

>Dsui_2972 leucyl/phenylalanyl-tRNA--protein transferase (Dechlorosoma suillum PS)
MLPWLTAAHEFPPLATALSEPNGLLAVGGDLAPERLLAAYRRGIFPWYSPGEPILWWSPD
PRMVLFPAEFKVSRSLGRTLRRGGYEVRLDTAFARVIAACAQTPRRGQHGTWIVPEMQAA
YRRLHELGLAHSVETWVDGELVGGLYGIALGRMFYGESMFSWRSDASKIAVAHLARYLER
LGFGMVDCQMHTAHLASLGAREIPRDDFIARLDALVAAGPASGPWPAADASHLWHSAA