Protein Info for Dsui_2957 in Dechlorosoma suillum PS

Annotation: cobalt ABC transporter, permease protein CbiQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 transmembrane" amino acids 22 to 51 (30 residues), see Phobius details amino acids 62 to 84 (23 residues), see Phobius details amino acids 106 to 130 (25 residues), see Phobius details amino acids 138 to 157 (20 residues), see Phobius details amino acids 224 to 242 (19 residues), see Phobius details PF02361: CbiQ" amino acids 10 to 209 (200 residues), 107.8 bits, see alignment E=3.3e-35 TIGR02454: cobalt ECF transporter T component CbiQ" amino acids 15 to 205 (191 residues), 119.7 bits, see alignment E=7.3e-39

Best Hits

KEGG orthology group: K02008, cobalt/nickel transport system permease protein (inferred from 60% identity to dar:Daro_1695)

Predicted SEED Role

"Transmembrane component CbiQ of energizing module of cobalt ECF transporter" in subsystem Coenzyme B12 biosynthesis or ECF class transporters or Transport of Nickel and Cobalt

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGW0 at UniProt or InterPro

Protein Sequence (243 amino acids)

>Dsui_2957 cobalt ABC transporter, permease protein CbiQ (Dechlorosoma suillum PS)
MLIEQSAYANRWRGVAPQAKGLFALGGVTAAFVAATTPAAGLGVAALLAAVTIGGARVSP
LLYLRVAAPALFFLAISALSLAVSVDGGGLQATAAGTHQAAVVATRSLGALAALLFLVLT
TPLSDLIALLRRLRTPEVLLDIMVLCYRTLFVFAAALQDMRAAQAARLGHLDRSRLLRSL
GQMAAHLTLQVWQRSHALHLAALARNNDGPLRFLGSRHPHARRDAGLAGVAALALVLLAW
SGR