Protein Info for Dsui_2953 in Dechlorosoma suillum PS

Annotation: diguanylate cyclase (GGDEF) domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 274 to 292 (19 residues), see Phobius details PF00497: SBP_bac_3" amino acids 45 to 252 (208 residues), 125.7 bits, see alignment E=2e-40 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 303 to 462 (160 residues), 165 bits, see alignment E=6.3e-53 PF00990: GGDEF" amino acids 308 to 460 (153 residues), 150.7 bits, see alignment E=3.1e-48

Best Hits

KEGG orthology group: None (inferred from 54% identity to dma:DMR_31090)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGV6 at UniProt or InterPro

Protein Sequence (464 amino acids)

>Dsui_2953 diguanylate cyclase (GGDEF) domain-containing protein (Dechlorosoma suillum PS)
MSLKTALALCAACLSLSPLPGVASEPASIVFTAAEQAYLDRVQSVKMCVDPDWEPFERIN
EQGRHEGIGADLVQLVAQRVGLRIELLPVRTWDESLAAAKAGRCQLMSFLNQSPERDRWL
DFTSPIFTDPNIIVTREEHAFVGDLPGLSGESVALPRGTMVEERIRKDFPNLRVILTGSE
PEAVSLVSERRADLTVRSLIVAAYAIRKEGLFNLKIAGQIPAYTNQLRIGVIKDEPLLRD
ILDKGVRTVTPQEREAIANRHVAIKVEQHTDYSLLWKSLAVAAFVLAVVIYSNRKLSALN
RELERLSVTDKLTGLFNRMKLDEVLESEIQRSQRFGQPFSLILLDLDHFKLVNDCHGHQA
GDQVLLEVARLLQRHTRETDLAGRWGGEEFMVVCPHTDEAGARVLAEDLRRVFELNEFPV
VRLKTASFGVATYRPDDQAKDIVARADAALYRAKDLGRNRVEWQ