Protein Info for Dsui_2951 in Dechlorosoma suillum PS

Annotation: putative iron-regulated membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 159 to 183 (25 residues), see Phobius details amino acids 238 to 258 (21 residues), see Phobius details amino acids 390 to 412 (23 residues), see Phobius details PF03929: PepSY_TM" amino acids 12 to 414 (403 residues), 181.9 bits, see alignment E=1.3e-57

Best Hits

KEGG orthology group: None (inferred from 55% identity to mms:mma_3524)

Predicted SEED Role

"Uncharacterized iron-regulated membrane protein; Iron-uptake factor PiuB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGV4 at UniProt or InterPro

Protein Sequence (425 amino acids)

>Dsui_2951 putative iron-regulated membrane protein (Dechlorosoma suillum PS)
MKRLRPLLVLGHRWCGLFMAAFLVVTGLTGAVISWDHELDEWLNGHLLHSATPGHPRDPL
ALAAAAEARHPEIQVTYIPLATEPGHSLALWVEPRPTADGSALLRPGFNQIFLDPVSGEE
LGRREWGAVWPVNRENAVSFLYKLHFSLHLPEFWGIDHWGVWLLGGVALLWTLDCFTGLL
LTLPRLQSGTGRQARQDAPHQAGIAEKRSWWARWAIAWKVRWRSGAYRLNFDLHRAGSLW
TWALLLVLAFTAFSLNLYREVFFPAMSLVSAVTPTPFETREASPPTRPRVPALGYAPILE
LARAEAARRGWPEPAGGVYYAREYGFYTVEFFHPEDEHGAGGVGHKQLYLDGDDGRPLGQ
RLPWQGSAADIFVQAQFPLHSGRILGLPGHILVSLMGLVVAGLAVTGVYLWWKKRRGRQR
GAART