Protein Info for Dsui_2947 in Dechlorosoma suillum PS

Annotation: putative metal-dependent hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 PF01863: YgjP-like" amino acids 99 to 160 (62 residues), 42.8 bits, see alignment E=3.3e-15

Best Hits

Swiss-Prot: 60% identical to UTPP_ECOLI: UTP pyrophosphatase (ygjP) from Escherichia coli (strain K12)

KEGG orthology group: K07043, (no description) (inferred from 68% identity to slt:Slit_0665)

Predicted SEED Role

"COG1451: Predicted metal-dependent hydrolase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGV0 at UniProt or InterPro

Protein Sequence (188 amino acids)

>Dsui_2947 putative metal-dependent hydrolase (Dechlorosoma suillum PS)
MSGSGKAGATDYLAGYPAELTARVQHLIGQGRLAPWLLERYPRAHEVRTDRALYDYVLEL
KGRHLRNAETPSKVAFDSKLHDLRNALGTHTTVARVQGGKLKAKREIRVSALFREMPEAF
LRMIVVHELAHLKERQHDKAFYQLCRHMEADYHQLEFDLRTYLCYLEQGGAPLWAAASPS
SPGEAPPA