Protein Info for Dsui_2921 in Dechlorosoma suillum PS

Annotation: isochorismate synthase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 479 TIGR00543: isochorismate synthase" amino acids 126 to 464 (339 residues), 238.5 bits, see alignment E=6.5e-75 PF00425: Chorismate_bind" amino acids 208 to 456 (249 residues), 193 bits, see alignment E=3.5e-61

Best Hits

Predicted SEED Role

"Menaquinone-specific isochorismate synthase (EC 5.4.4.2)" in subsystem Menaquinone and Phylloquinone Biosynthesis (EC 5.4.4.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.4.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGD9 at UniProt or InterPro

Protein Sequence (479 amino acids)

>Dsui_2921 isochorismate synthase family protein (Dechlorosoma suillum PS)
MSRPQTRPAAGTASLSQRYPGLAGELAALAARARPTDLLSLCLPAPPLPMAGPLPYLAAP
DSLAWQRPDDAWLALGAACTVESAGPGRFTALNGAWQGLAARWQIAATSQDSDGSDGLQA
PLAHLGFAFYDTSGDSPLPNARLRVPALLLRRRAGRQTLVLTCPAHGAAQAMAGWEALWQ
TLERTLLSQPAPLAALHLQRPPAPLPEQAFVARTRAALAAIARGELDKVVLSRRVAFEAD
SPLEAAAVFAALAAQQADSSVFAVGHRAGTFLGATPERLLSLQDGRLHTEALAGTGWGRA
DAPLTSDKNQREHGWVAEAIRHTLAPLCAELQAAPAEVLQLPGGRRHAGLSHLRTPFHGR
PAPGVGLFDLAARLHPTPAVGGWPAAPAREWLQAHGEERPLWYSGGLGWIDAAGNGTLAV
PLRCADLRGNRAELQAGAGIVAGSAAEQELAETEAKLATMLEALAPSAPAPAAASRRGA