Protein Info for Dsui_2913 in Dechlorosoma suillum PS

Annotation: dihydroxynaphthoate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 TIGR01929: naphthoate synthase" amino acids 14 to 272 (259 residues), 403.8 bits, see alignment E=1.7e-125 PF00378: ECH_1" amino acids 22 to 270 (249 residues), 247.2 bits, see alignment E=1.7e-77 PF16113: ECH_2" amino acids 26 to 203 (178 residues), 74 bits, see alignment E=1.6e-24

Best Hits

Swiss-Prot: 72% identical to MENB_SALTY: 1,4-dihydroxy-2-naphthoyl-CoA synthase (menB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01661, naphthoate synthase [EC: 4.1.3.36] (inferred from 86% identity to dar:Daro_1616)

MetaCyc: 70% identical to 1,4-dihydroxy-2-naphthoyl-CoA synthase (Escherichia coli K-12 substr. MG1655)
Naphthoate synthase. [EC: 4.1.3.36]

Predicted SEED Role

"Naphthoate synthase (EC 4.1.3.36)" in subsystem Menaquinone and Phylloquinone Biosynthesis (EC 4.1.3.36)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGD1 at UniProt or InterPro

Protein Sequence (276 amino acids)

>Dsui_2913 dihydroxynaphthoate synthase (Dechlorosoma suillum PS)
MIRPALPWVAQADYSDIRYETCDGIAKITINRPERRNAFRPETVMQLIDAFHLAHRDNAV
GAIILTGEGPDAFCAGGDQKVRGDDGGYHDESGTPHLNVLDLQMQIRRLPKPVVAMVAGY
AIGGGHVLHLVCDLSIAAENARFGQTGPRVGSFDAGLGAGLMARTIGMKRAKEIWFLCRQ
YDAVQALDWGLVNTVVPVEKLEEETVAWCQEMLRLSPMALRMLKAGFNADTDGLAGIQEL
AGNATGLFYMTEEGQEGRDAWLERRPPDFGKYRKRP