Protein Info for Dsui_2903 in Dechlorosoma suillum PS

Annotation: methyltransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 PF13489: Methyltransf_23" amino acids 34 to 144 (111 residues), 28.5 bits, see alignment E=4.1e-10 PF13847: Methyltransf_31" amino acids 40 to 140 (101 residues), 29.8 bits, see alignment E=1.6e-10 PF03848: TehB" amino acids 42 to 139 (98 residues), 22.4 bits, see alignment E=2.6e-08 PF13649: Methyltransf_25" amino acids 43 to 135 (93 residues), 63.1 bits, see alignment E=1.1e-20 PF08241: Methyltransf_11" amino acids 44 to 138 (95 residues), 53.8 bits, see alignment E=8.6e-18 PF08242: Methyltransf_12" amino acids 48 to 137 (90 residues), 36.1 bits, see alignment E=3.2e-12

Best Hits

KEGG orthology group: None (inferred from 70% identity to tmz:Tmz1t_3545)

Predicted SEED Role

"Biotin synthesis protein BioC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGC1 at UniProt or InterPro

Protein Sequence (206 amino acids)

>Dsui_2903 methyltransferase family protein (Dechlorosoma suillum PS)
MSQHEKFWSERFSAAGEDYLFGTAPTRFLALHEFLLGAGSTALSVADGEGRNSVWLAEQG
LQVTAVEVSPVAVDKARRLAAGRGVLVDFQVADLLAWAWPEAAYDLVVAVFIQFANPAEQ
ERIFAGMAQALKPGGRLLLHGYTPKQLEYRTGGPSAVENLYTPELLRQAFAGLEIEELRE
YEAELHEGLAHRGRSALIDLVARKPG