Protein Info for Dsui_2889 in Dechlorosoma suillum PS

Annotation: parvulin-like peptidyl-prolyl isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF13145: Rotamase_2" amino acids 119 to 240 (122 residues), 67.8 bits, see alignment E=2.4e-22 PF13616: Rotamase_3" amino acids 137 to 228 (92 residues), 75.2 bits, see alignment E=9.6e-25 PF00639: Rotamase" amino acids 150 to 227 (78 residues), 71.5 bits, see alignment E=1.4e-23

Best Hits

Swiss-Prot: 46% identical to PLP1_BORBR: Probable parvulin-type peptidyl-prolyl cis-trans isomerase (BB3803) from Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)

KEGG orthology group: K03769, peptidyl-prolyl cis-trans isomerase C [EC: 5.2.1.8] (inferred from 66% identity to dar:Daro_2906)

Predicted SEED Role

"Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8)" in subsystem Queuosine-Archaeosine Biosynthesis (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGA7 at UniProt or InterPro

Protein Sequence (266 amino acids)

>Dsui_2889 parvulin-like peptidyl-prolyl isomerase (Dechlorosoma suillum PS)
MQTISKSASKLAAALVCGALLSANAMAQKAPAAVVVNGTAVPQSLADAFIAEQKAQGAPE
GPELRAAVREELVRREILSQEAKKKGLDKKADVAAQMGLASQAVLIRAFIQDYLAKHPVT
DAQLKKDYEEIKSKLGGKEYKARHILVDNETEAKVILDKLKKGEKFEELAKQSKDPGSKD
NGGDLGWSNPSNYVKPFADALVRLEKGKLTDAPVKSDFGWHIIQLEDTRPLNPPPFDQVK
GQLQQRAQQQIVENMVKDLRAKAKVE