Protein Info for Dsui_2883 in Dechlorosoma suillum PS

Annotation: biotin biosynthesis protein BioC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 TIGR02072: malonyl-acyl carrier protein O-methyltransferase BioC" amino acids 9 to 256 (248 residues), 190.5 bits, see alignment E=2.1e-60 PF13649: Methyltransf_25" amino acids 48 to 136 (89 residues), 48.7 bits, see alignment E=1.6e-16 PF08241: Methyltransf_11" amino acids 48 to 140 (93 residues), 58.7 bits, see alignment E=1.2e-19

Best Hits

KEGG orthology group: K02169, biotin synthesis protein BioC (inferred from 56% identity to app:CAP2UW1_2158)

Predicted SEED Role

"Biotin synthesis protein BioC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGA1 at UniProt or InterPro

Protein Sequence (257 amino acids)

>Dsui_2883 biotin biosynthesis protein BioC (Dechlorosoma suillum PS)
MEKHHIRRAFDRAADSYDQAAALQRQVCDALESSLPPGDGQLPAGFLLDAGCGTGYGADL
LAHRYPGRPLLLADFAPAMLARAREGDNAGLPLCADLEHLPLAAGGAALYWSSLAVQWCD
LSRSLKEAARVLAPGGVLAFSTLGPGTFAELGEAFAGIDSHRHVLPFAPPATCGEAMLGA
GFQELRVERRKLQIFYPDLRSLLRAIKDIGANQVGGARRTGFLGKAAWKTVEARYERHRS
AAGLPATYDVVLCTAVK