Protein Info for Dsui_2882 in Dechlorosoma suillum PS

Annotation: putative hydrolase or acyltransferase of alpha/beta superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 PF00975: Thioesterase" amino acids 8 to 104 (97 residues), 27.7 bits, see alignment E=7.9e-10 PF00561: Abhydrolase_1" amino acids 8 to 233 (226 residues), 78.6 bits, see alignment E=1.5e-25 PF12697: Abhydrolase_6" amino acids 9 to 238 (230 residues), 78.9 bits, see alignment E=2.2e-25 PF12146: Hydrolase_4" amino acids 54 to 230 (177 residues), 41.6 bits, see alignment E=2.5e-14

Best Hits

KEGG orthology group: K02170, biotin biosynthesis protein BioH (inferred from 44% identity to app:CAP2UW1_2159)

Predicted SEED Role

"Biotin synthesis protein BioH"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGA0 at UniProt or InterPro

Protein Sequence (250 amino acids)

>Dsui_2882 putative hydrolase or acyltransferase of alpha/beta superfamily (Dechlorosoma suillum PS)
MNSPAKRPLVLLHGWGLDSRVWEALLPHLTPHFSVTRLQLPGYPGRPDGADSVAATVDAL
LADVPEGALLLGWSLGGQLAQLMAARAPKRIAGLVLVATSPRFLAGNGWNAGQPASLLGG
FSAAVGLAPGPVLPRFTTLMNQGDSLAKDINRQLAPLTKPPLAEKAALLRGLDWLRDLDL
RPLAPKLPHPILVIHGEADPLMPVEAARWLATQLPHGRLQLMAEAAHTPFLHDPVAFAGH
VQAWAEGLPA