Protein Info for Dsui_2879 in Dechlorosoma suillum PS

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 498 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 192 to 213 (22 residues), see Phobius details PF08269: dCache_2" amino acids 33 to 181 (149 residues), 133.5 bits, see alignment E=2.3e-42 PF17200: sCache_2" amino acids 38 to 184 (147 residues), 140.8 bits, see alignment E=8.7e-45 PF17201: Cache_3-Cache_2" amino acids 72 to 182 (111 residues), 36.9 bits, see alignment E=6.8e-13 PF00672: HAMP" amino acids 208 to 258 (51 residues), 33.3 bits, see alignment 1.2e-11 PF00015: MCPsignal" amino acids 322 to 481 (160 residues), 119.8 bits, see alignment E=3e-38

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 44% identity to ssm:Spirs_0366)

Predicted SEED Role

"Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QG97 at UniProt or InterPro

Protein Sequence (498 amino acids)

>Dsui_2879 methyl-accepting chemotaxis protein (Dechlorosoma suillum PS)
MKNMKLGWKLFLLVALAVAGFLVNSGQGLFLLKDNLLEDRKLKTKNVVETAHGILAYYYR
EQQAGRLSEEDARQTAAAAIKGLRYEGEEYFFLMDFNANIVMHPIKPEMDGKNFAETKDP
KGNRLFSEMSRIGRDVGQGYYAYFWPKPGKSEPVEKISYVKAFKEWGWLVGSGIYIDDVD
AVFFKAATTQGSLAIGGLILLIGFSVYLMKTIVGPVQRMQKVMEALAEGDMTVHASSDAR
DEIGLMLQAAERMIDRTRKVIQEVRVSADALVNASDQVSVTSHSLSQSASEQAASVEETS
ASIEQMSANIEHNKDNAHLTQDMSARAASDAQVGGKTVGATVEAMKQIADKIGIVDEIAY
QTNLLALNAAIEAARAGEHGKGFAVVAGEVRKLAERSQAAAHEIGELAGKSVEQAENAGR
LFQDMMPNIEKTAQLVKEIAASSEEQAIGAGQISQAISQVNQTTQHNASASEELAATAQE
LHSQAERLKQNIAFFRID