Protein Info for Dsui_2876 in Dechlorosoma suillum PS

Annotation: RND family efflux transporter, MFP subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 40 to 309 (270 residues), 194.2 bits, see alignment E=1.4e-61 PF25973: BSH_CzcB" amino acids 64 to 196 (133 residues), 39.6 bits, see alignment E=1.2e-13 PF25917: BSH_RND" amino acids 64 to 201 (138 residues), 55.5 bits, see alignment E=1.3e-18 PF25876: HH_MFP_RND" amino acids 104 to 172 (69 residues), 31.8 bits, see alignment E=4.2e-11 PF25990: Beta-barrel_YknX" amino acids 212 to 287 (76 residues), 44.4 bits, see alignment E=5.1e-15 PF25954: Beta-barrel_RND_2" amino acids 218 to 288 (71 residues), 46.5 bits, see alignment E=1.1e-15

Best Hits

KEGG orthology group: K02005, HlyD family secretion protein (inferred from 62% identity to app:CAP2UW1_1980)

Predicted SEED Role

"Macrolide-specific efflux protein MacA" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QG94 at UniProt or InterPro

Protein Sequence (418 amino acids)

>Dsui_2876 RND family efflux transporter, MFP subunit (Dechlorosoma suillum PS)
MKRPQKKTVVLILAALLLAGGGYVAYQKLTAPGLEQRYKLQTLEKGELTQSVSANGTLNP
VTLVNVGTQVSGTVKKLYVDFNDQVKQGQILAELDDSLYSAQVHQSDANIASARASLDLA
IASEERMKSLFAQEYVSRQELDQAVQARRSAQAQLNQYKAANDKDRANLGYSVIRSPVSG
VVVDRQIDVGQTVAASFQTPTLFKIAQDLTAMQIYTSFAEADIGNIKVGQPVKFNVDAFP
NRQFKGEVKQVRLNPTTQQNVVTYNVVVVVDNPEQILLPGMTAYVNIAVAKRSDVLLVPN
AALRYKPNGGQKPAPNAASNAAANGAPAGGPPGAAGPGNGKGAGERQRKRDSASGTVHVL
RGGEVVPVSVSLGITDNRNTEIVGGELNAGDQVIVGENLPDGANAGGSSGGTMRMRMF