Protein Info for Dsui_2873 in Dechlorosoma suillum PS

Annotation: Peroxiredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 PF08534: Redoxin" amino acids 3 to 140 (138 residues), 74.6 bits, see alignment E=1.1e-24 PF00578: AhpC-TSA" amino acids 4 to 133 (130 residues), 129 bits, see alignment E=1.5e-41

Best Hits

Swiss-Prot: 43% identical to BCP_MYCTO: Putative peroxiredoxin MT2597 (bcp) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K03564, peroxiredoxin Q/BCP [EC: 1.11.1.15] (inferred from 73% identity to app:CAP2UW1_3323)

MetaCyc: 39% identical to thiol peroxidase (Escherichia coli K-12 substr. MG1655)
1.11.1.15-RXN [EC: 1.11.1.24]

Predicted SEED Role

"Alkyl hydroperoxide reductase subunit C-like protein" in subsystem Oxidative stress or Rubrerythrin or Thioredoxin-disulfide reductase

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.15

Use Curated BLAST to search for 1.11.1.15 or 1.11.1.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QG91 at UniProt or InterPro

Protein Sequence (154 amino acids)

>Dsui_2873 Peroxiredoxin (Dechlorosoma suillum PS)
MLKPGQAAPEFALPDADMELVELAAYKGKRHIILFFYPRDDTPGCTLEATDFSDHEDEFE
RRDCTLLGISRDDCLRHAAFRDKHGISVRLLSDEEGQVCRRYGVWQAKEVDGVKKHGILR
STFVIDKQGLVRHAFYGVNAKGHALEMLRLAKEL