Protein Info for Dsui_2869 in Dechlorosoma suillum PS

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00126: HTH_1" amino acids 12 to 71 (60 residues), 71.8 bits, see alignment E=3.6e-24 PF03466: LysR_substrate" amino acids 96 to 301 (206 residues), 174.5 bits, see alignment E=1.9e-55

Best Hits

Swiss-Prot: 48% identical to RBCR_ACIFR: RuBisCO operon transcriptional regulator (rbcR) from Acidithiobacillus ferrooxidans

KEGG orthology group: None (inferred from 72% identity to tmz:Tmz1t_0634)

Predicted SEED Role

"RuBisCO operon transcriptional regulator" in subsystem CO2 uptake, carboxysome

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QFU2 at UniProt or InterPro

Protein Sequence (323 amino acids)

>Dsui_2869 transcriptional regulator (Dechlorosoma suillum PS)
MYRLGGSLHLTLHQLRLLLATAQEGSVSRAAERLHLTQPTLSAQLKQLAEQVGLPLHERV
GRRLHLTEAGRLVAATAARVAEELGQLENELAVLRGDQGGRLRLAVVSTAEAFIPRLLGE
FRKVRPAVEVSLVVLNRQAVVGRLLENQDDLYIMTKPPAETPVSAVPFLTNPLVVVAAAD
HPLATRKQVAAGALADAEFVLREPGSGTRLAAEEFFAARGVQLRPRLELGSNEAVRQAVA
GGLGLSVLSAHALGPHPEELGIAVLPVRGTPIPARWQVVAPAGKRLTPLAQAFLDYLQER
APRLEAEAGQRLALAVAGAIPGR