Protein Info for Dsui_2860 in Dechlorosoma suillum PS

Annotation: single-stranded-DNA-specific exonuclease RecJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 565 transmembrane" amino acids 183 to 201 (19 residues), see Phobius details TIGR00644: single-stranded-DNA-specific exonuclease RecJ" amino acids 23 to 560 (538 residues), 489.2 bits, see alignment E=6.3e-151 PF01368: DHH" amino acids 73 to 231 (159 residues), 99.9 bits, see alignment E=2e-32 PF02272: DHHA1" amino acids 356 to 448 (93 residues), 70.9 bits, see alignment E=1.7e-23 PF17768: RecJ_OB" amino acids 464 to 561 (98 residues), 70.6 bits, see alignment E=1.7e-23

Best Hits

Swiss-Prot: 49% identical to RECJ_HAEIN: Single-stranded-DNA-specific exonuclease RecJ (recJ) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K07462, single-stranded-DNA-specific exonuclease [EC: 3.1.-.-] (inferred from 73% identity to dar:Daro_2838)

MetaCyc: 52% identical to ssDNA-specific exonuclease RecJ (Escherichia coli K-12 substr. MG1655)
Exodeoxyribonuclease VII. [EC: 3.1.11.6]

Predicted SEED Role

"Single-stranded-DNA-specific exonuclease RecJ (EC 3.1.-.-)" in subsystem DNA-replication or DNA Repair Base Excision or DNA repair, bacterial RecFOR pathway (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-, 3.1.11.6

Use Curated BLAST to search for 3.1.-.- or 3.1.11.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QFT3 at UniProt or InterPro

Protein Sequence (565 amino acids)

>Dsui_2860 single-stranded-DNA-specific exonuclease RecJ (Dechlorosoma suillum PS)
MTQLIARPVPPRPQWQLEQEGLHPLLARIYAARGIKHKAELDYDLKSLIPPSQLTGTEEA
AILLADAIEAEARILVVGDYDCDGATATAVAVRALRLLGGTVDYLVPDRFVHGYGLSPQI
VELAAERQPDLLVTVDNGIASIEGVEAARQLGIATLITDHHLPAETLPEADCIVNPNQPG
CTFPSKALAGVGVMFYVALALRAEMRRRGAFGPERPEPNFSCLLDLVALGTVADVVKLDH
NNRILVAQGLKRMREGKLTPGIRALFRAAGRNLQTASAFDLGFTVGPRLNAAGRLSDMSL
GIECLITDDEARAANIAQQLDQLNRERREIEAGMQEQALIHLENFDLEASGAGVALFDPD
WHQGVVGILASRIKEKLHRPVFAFARGDDGQIKGSGRSIPGLHLRDALDLVSKRAPGILL
RFGGHAMAAGATLMEERFEEFKSLFAQVADELLNPADLTRTLETDGALEAGYISLQVAEM
LAGEVWGQGFPAPLFEDVFEVESQRVLKDKHLKLRLKKERSVLEAIQFNATENPGPRARL
AYRLTINDYNGVQTPQLVVEHCAPA