Protein Info for Dsui_2840 in Dechlorosoma suillum PS

Annotation: His-Xaa-Ser repeat-associated downstream radical SAM protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 TIGR03977: His-Xaa-Ser system radical SAM maturase HxsC" amino acids 81 to 370 (290 residues), 403.1 bits, see alignment E=2.7e-125 PF04055: Radical_SAM" amino acids 109 to 258 (150 residues), 50 bits, see alignment E=2.1e-17

Best Hits

KEGG orthology group: None (inferred from 70% identity to reh:H16_B0467)

Predicted SEED Role

"His-Xaa-Ser system radical SAM maturase HxsC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QFR6 at UniProt or InterPro

Protein Sequence (384 amino acids)

>Dsui_2840 His-Xaa-Ser repeat-associated downstream radical SAM protein (Dechlorosoma suillum PS)
MLTLSGKVIQLQTTMPSGRHLWVLSTNPDLPRPLRCSRAFLINSAVIPSGFSHYLAFGSV
PVSLPERATCTVLGNEFSYLGENDVISLTSDGRIRSMFRANSPHNSIMLTEQCNNYCLMC
SQPPKNVDDRWLLDEAMELVRLIPRHAAKVMCISGGEPTLLGDGFIDLLHLLKSRLPDAA
LHVLSNGRRFSNVAFSKKYAAVQHPDLMVGIPVYSADPAKHDYVVQAKGAFDETIRGILN
LKRLNQRVEIRVVVHKQTCDGLPALAEYIARNLLFVDQVALMGLEMTGFTRANLESLWID
PVEYKDKLSQAVKILQNYGIKVSVYNQPLCLVSPDIEQAYVKSISDWKNEYAQECGPCTR
KSECGGFFSSAIQYGYSGSISPFQ