Protein Info for Dsui_2818 in Dechlorosoma suillum PS

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 PF06167: Peptidase_M90" amino acids 12 to 250 (239 residues), 288.4 bits, see alignment E=2.5e-90

Best Hits

Swiss-Prot: 39% identical to MTFA_SERP5: Protein MtfA (mtfA) from Serratia proteamaculans (strain 568)

KEGG orthology group: K09933, hypothetical protein (inferred from 58% identity to app:CAP2UW1_1060)

Predicted SEED Role

"Inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QFP4 at UniProt or InterPro

Protein Sequence (266 amino acids)

>Dsui_2818 hypothetical protein (Dechlorosoma suillum PS)
MGWLDRLLGRRRPRPIPQPLWQQTVARLPFLQWLPAADLARLQSLSEAFLAAKQFSGAAG
LEVDDAMGVHIAAQGCLPILNLGLEWYDDWVEIIVYPDEFVVPRQEMDPDGVVHEYDEVA
AGQAWDGGPLILSWQDSQMAGDGYNVVIHEFAHKLDMINGAPDGLPPLHPGMDKEAWIAA
LDGAYDDFLARVERAEARGEEALEQLPIDPYGAEHPGEFFAVVSESFFEQPQVVAAEYPA
LYAQLALFYRQDPLARAQAAGSSRSR