Protein Info for Dsui_2811 in Dechlorosoma suillum PS

Annotation: ABC-type transport system involved in resistance to organic solvents, ATPase component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 PF00005: ABC_tran" amino acids 23 to 171 (149 residues), 99 bits, see alignment E=3.7e-32 PF13304: AAA_21" amino acids 136 to 205 (70 residues), 40.2 bits, see alignment E=4.2e-14

Best Hits

KEGG orthology group: K02065, putative ABC transport system ATP-binding protein (inferred from 71% identity to app:CAP2UW1_1066)

Predicted SEED Role

"Methionine ABC transporter ATP-binding protein" in subsystem Methionine Biosynthesis or Methionine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QFN7 at UniProt or InterPro

Protein Sequence (257 amino acids)

>Dsui_2811 ABC-type transport system involved in resistance to organic solvents, ATPase component (Dechlorosoma suillum PS)
MSRPVIEVHGLWSRYGDTVIHRELDLVVEQGQMVGLVGGSGSGKTTLLREVVGLLRPWKG
RVHLFDCPLYSGDPGVDRALRQRFGMLFQQGALYSALSVFDNVAFPLREFGLEDESLIRD
LVHLKLAMVELDPRHGLLKPAELSGGMVKRVALARALALEPELLILDEPTAGLDPDRSEG
FVRLIRELQAELGFTVIMVTHDLATLTGLSTHIAVLADQRIVAFGTPEEVRRVEHPFISS
FFGGAAAAPGPAAPAPL