Protein Info for Dsui_2804 in Dechlorosoma suillum PS

Annotation: diguanylate cyclase (GGDEF) domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 538 transmembrane" amino acids 14 to 36 (23 residues), see Phobius details amino acids 296 to 318 (23 residues), see Phobius details PF02743: dCache_1" amino acids 51 to 277 (227 residues), 51.3 bits, see alignment E=1.9e-17 PF00672: HAMP" amino acids 317 to 364 (48 residues), 33.9 bits, see alignment 4.8e-12 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 371 to 536 (166 residues), 144.8 bits, see alignment E=9.9e-47 PF00990: GGDEF" amino acids 374 to 531 (158 residues), 163.1 bits, see alignment E=7e-52

Best Hits

KEGG orthology group: None (inferred from 55% identity to azo:azo2326)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QFN0 at UniProt or InterPro

Protein Sequence (538 amino acids)

>Dsui_2804 diguanylate cyclase (GGDEF) domain-containing protein (Dechlorosoma suillum PS)
MMGTMRLRQLSHSIILRILLLGLGIVVVGTTARYFILSQFLREDLDKVVASQQQALASYV
ARDVDSKLVERRDLLQRLAASLPRQLLGQPRQLRAWLQERHELHPLFNQGLLLVDSRGAI
LADFPERPLQARINLADREYVQAALAGEASLGRPAPDWLDREPVLPMAAPVRDEQGRVQA
ALVGLTPLATPGFLNLLLQSRIGRSGGFLLISPRDRVFVAATEPELVLKPTPPAGVNPLH
DRAMAGYRGTGITVNAKGVEEAVAIVSVPSAEWFVVARLPTAEAFEPVTRVQQYILRNSV
VVSLVFLVLASLGLAHVFRPLRRTAEHADRMTRGECPLEPLPVLRNDEVGHLTAAFNRLL
RKLSESQAALAQAAHHDALTGLPNRMLLADRLSQARVLAQRKGSRIALLFLDLDGFKPIN
DSLGHEAGDEVLRLVAGRLSGCVRASDTLARVGGDEFVILMGDLDSQAEQAAARVAAKCI
EALAEPFPVQDQSCRLGVSIGIALGDGESAANTLLLQADQAMYRAKESGRGRYVIATT