Protein Info for Dsui_2799 in Dechlorosoma suillum PS

Annotation: oligopeptide/dipeptide ABC transporter, ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 670 PF00005: ABC_tran" amino acids 25 to 183 (159 residues), 94.4 bits, see alignment E=2.8e-30 amino acids 379 to 530 (152 residues), 110.5 bits, see alignment E=3.1e-35 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 232 to 317 (86 residues), 101.4 bits, see alignment E=3.4e-33 amino acids 579 to 666 (88 residues), 85.7 bits, see alignment E=2.6e-28 PF08352: oligo_HPY" amino acids 234 to 298 (65 residues), 77.1 bits, see alignment E=3.4e-25 amino acids 581 to 646 (66 residues), 71.6 bits, see alignment E=1.8e-23 PF13401: AAA_22" amino acids 388 to 557 (170 residues), 27.5 bits, see alignment E=1.1e-09

Best Hits

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein K02032, peptide/nickel transport system ATP-binding protein (inferred from 62% identity to tbd:Tbd_1668)

Predicted SEED Role

"Dipeptide transport ATP-binding protein DppF (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QFM5 at UniProt or InterPro

Protein Sequence (670 amino acids)

>Dsui_2799 oligopeptide/dipeptide ABC transporter, ATP-binding protein (Dechlorosoma suillum PS)
MSDLLSVRNLKAGFLAGGRVLTAVDGVSFAVAPGETFALLGESGCGKSATALALLRLLPN
AGRIQGGEVWLEGEEILALPEAAMRDRRGSAAAMIFQEPATSLNPVLTIGRQIGESLERH
RGMKGEAARREALALLTAVGIADPERRLEEYPFQLSGGMKQRAMIAIALAGEPRLLIADE
PTTALDVTIQAQILDLLARLQAERAMGMLLITHDLGVVARSAHRVGVMYAGEIVETAPRQ
EFFASPRHPYTQKLFAALPDLGQRGAQLATIPGQVPGLAAMPAGCRFAPRCPVAMDRCRL
ESPGWTELEAGHQVRCHWVAQQLPGGEQRLPDLPAAPPAAAAAADAARENLLAVGELKVH
FPIRKGLFKRTVGHVKAVDGVSLELQRGRTLALVGESGCGKTTAGKAVLRLLPATGSVRL
DGRELLGLPERELKPLRRRMQMVFQDPFASLNPRLTVGEIIEEGMTALRVAASRDERRAA
LAALLESVGLPAEALGRYPHEFSGGQRQRIAIARALAVQPELLVCDEPTSALDVSVQAQI
LNLLRRLQEELGLAYLFITHNFAVVEYLAHDVAVMYLGRIVEQGPVQQVLAAPCHPYTRA
LLSAVPEPRLAGQREMVRLPGETPSPARPPQGCHFHPRCAQASERCRQEYPAPSTQAGGV
VVRCHLYPAD