Protein Info for Dsui_2797 in Dechlorosoma suillum PS

Annotation: LysM repeat-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 605 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details PF01464: SLT" amino acids 151 to 251 (101 residues), 89.4 bits, see alignment E=3.2e-29 PF01476: LysM" amino acids 370 to 413 (44 residues), 19.2 bits, see alignment 2.5e-07 amino acids 461 to 491 (31 residues), 44.5 bits, see alignment (E = 2.9e-15) amino acids 558 to 599 (42 residues), 50.9 bits, see alignment 3e-17

Best Hits

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase D precursor (EC 3.2.1.-)" (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QQ29 at UniProt or InterPro

Protein Sequence (605 amino acids)

>Dsui_2797 LysM repeat-containing protein (Dechlorosoma suillum PS)
MTLDDTLGCTLRFIRQLHRSLPALACGALFAATPAQANDQPLTLSFAPSLQSMVPSRTEL
SARPEASPVQNDGSLPVEEIAPIPQLPRTIDLTASPDNLWERIRNGFGMPNLNNDLVLTH
QQWYMNRPDYVRRMVERSRRYMFHIVEAIEKRGMPMELALLPMVESAYNPMAYSRSHASG
LWQFIPSTGKNFKLEQNWWVDDRRDIIASTSAALDYLQTIYEMHGDWQLALASYNWGEGA
VGRAIAKNRAKGLPTDYENLTMPAETRNYVPKLQALKNILSNPRLLAQLDLPQIPNQPYF
AAVAKPADMDVKVAAKLAEMPVDEFVALNPAHNRPVIKADRPLVLPAEKVERFRANLENN
EAPLSSWTSYTLKAGEKLDKVAARLGVSVAHLKTVNGLPPKAKVGAGTTLLVPARDGIEG
DLAVASFTPPAAETAPARSDARADSRADSRNEPRAQPAKFHVVKKGDTLFSIARRYDVSV
DELKRWNKLGRNMAAGTKLTVAPAVAAPAAAAKTTVASAPANGRVSATLEGKNLKLSKND
KAPANAKAAAAKAKVARYTIRKGDTLAGIAKKFKVEADDIKRWNKVAPGNLKPGQTITIQ
LAQND