Protein Info for Dsui_2786 in Dechlorosoma suillum PS

Annotation: type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), B subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 657 PF02518: HATPase_c" amino acids 35 to 174 (140 residues), 49.3 bits, see alignment E=1.2e-16 PF00204: DNA_gyraseB" amino acids 223 to 398 (176 residues), 122.7 bits, see alignment E=2.4e-39 PF01751: Toprim" amino acids 426 to 540 (115 residues), 47.8 bits, see alignment E=2.8e-16 PF00986: DNA_gyraseB_C" amino acids 585 to 647 (63 residues), 78.3 bits, see alignment E=7.7e-26

Best Hits

KEGG orthology group: K02622, topoisomerase IV subunit B [EC: 5.99.1.-] (inferred from 71% identity to hse:Hsero_1835)

Predicted SEED Role

"Topoisomerase IV subunit B (EC 5.99.1.-)" in subsystem DNA topoisomerases, Type II, ATP-dependent or Resistance to fluoroquinolones (EC 5.99.1.-)

Isozymes

Compare fitness of predicted isozymes for: 5.99.1.-

Use Curated BLAST to search for 5.99.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QQ25 at UniProt or InterPro

Protein Sequence (657 amino acids)

>Dsui_2786 type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), B subunit (Dechlorosoma suillum PS)
MSNPSDYNASSITVLKGLEPVKQRPGMYTRTENPLHIIQEVIDNAADEAIAGFAKSILVT
VHVDGSISVADNGRGIPVELHPVENAPTVEVVFTRLHAGGKFNKGAGGAYSFSGGLHGVG
VSVTNALSTRLEVEVAREGGMHRLVFAAGDVVEPLARIGDAPKKASGTRVRAWPDAKYFD
SPTIPMGELEHILRSKAVLLPGVAVTLHIERSGETKEWAYKDGMRGYLAELLDGTDLVIP
MIVGEKYAGKPTNGDGFAEGEGAAWAIAWTEEGALARESYVNLIPTPGGGTHESGLRDGI
FQAVKSFVDMHSLLPKGVKLLPEDVFGRASFLLSARILDPSFQGQTKDRLNSRDAVKLVS
AMFRDTFELWLNEHVEYGKKLAELSIKQAQSRQRSAQKVEKKKGSGVAVLPGKLTDCESD
DIERNELFLVEGDSAGGSAKQGRDKEFQALLPLRGKVQNSWEVEPDRLYANVEIHNIAVA
IGVDHHTLESDTSIDGLRYGKVIIMSDADVDGSHIQCLLLTLFFRHFPKLIANGNIYVAK
PPLFRVDVPGQGKNRPPRKIYALDENELEAVKDKLVKEGIKLEALSISRFKGLGEMSSEQ
LWDTTLNPDTRRLVRVEFGDYPMEETIAKMNMLMGKGEASSRREWLEVHGNEVEADI