Protein Info for Dsui_2747 in Dechlorosoma suillum PS

Annotation: uncharacterized integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 transmembrane" amino acids 40 to 58 (19 residues), see Phobius details amino acids 65 to 84 (20 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 129 to 150 (22 residues), see Phobius details amino acids 162 to 182 (21 residues), see Phobius details amino acids 188 to 207 (20 residues), see Phobius details amino acids 216 to 237 (22 residues), see Phobius details amino acids 257 to 274 (18 residues), see Phobius details PF05675: DUF817" amino acids 32 to 268 (237 residues), 323.8 bits, see alignment E=3.8e-101

Best Hits

KEGG orthology group: None (inferred from 63% identity to atu:Atu1921)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPY7 at UniProt or InterPro

Protein Sequence (285 amino acids)

>Dsui_2747 uncharacterized integral membrane protein (Dechlorosoma suillum PS)
MPLYATLRRLDLHLENRQERPALSGWRRFVAEFWWFGIKEARACIFAGLFFLALFVVPRG
GWLGIARYDLLLLIALALQAWLLWRRIETWDEARTILLFHLAGFALEVFKVSAPIASWSY
PDPALTKVLGVPLFSGFMYAAVGSYVMQAWRILHLRIERHPPYWMSGGLALLLYLNLFTH
HFIGDYRWYLAALALGLYARSSIVFPPLDRERSMPFLLGFILVGFFIWLAENMGTFLGVW
RYPNQLGAWATVHLGKWSSWTMLALMSFSLISGLKQVKARIQISP