Protein Info for Dsui_2743 in Dechlorosoma suillum PS

Annotation: Integral membrane protein CcmA involved in cell shape determination

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 PF04519: Bactofilin" amino acids 67 to 162 (96 residues), 66.9 bits, see alignment E=7.9e-23

Best Hits

KEGG orthology group: None (inferred from 49% identity to hse:Hsero_1591)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPY3 at UniProt or InterPro

Protein Sequence (202 amino acids)

>Dsui_2743 Integral membrane protein CcmA involved in cell shape determination (Dechlorosoma suillum PS)
MLNKQSLFSSKREETVLPRNPWPGSAPQTNSSNVSSAPKASTASTASAPPPAPVAADKEQ
PSGSRLIVGPDVKLKGAEIQDCDTLVVEGRVEATLDSRLIQIAEQGAFSGKVSIDVAEIR
GTFEGELVARKQLFIHASGRVSGTIRYGSILIDEGGQVSGDVRSLGDEHQAGSAKASPAE
PGIPTLHGNVTLKEGKKENALL