Protein Info for Dsui_2742 in Dechlorosoma suillum PS

Annotation: molecular chaperone

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 PF00012: HSP70" amino acids 10 to 83 (74 residues), 25.1 bits, see alignment E=2.6e-10 amino acids 89 to 230 (142 residues), 39.8 bits, see alignment E=9.4e-15 amino acids 301 to 396 (96 residues), 48.1 bits, see alignment E=2.9e-17

Best Hits

KEGG orthology group: K04046, hypothetical chaperone protein (inferred from 69% identity to azo:azo3626)

Predicted SEED Role

"Putative heat shock protein YegD" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPY2 at UniProt or InterPro

Protein Sequence (421 amino acids)

>Dsui_2742 molecular chaperone (Dechlorosoma suillum PS)
MPATAPRRACGLDFGTSNSTVGCLRPGQPTLLALEEGKVTLPSVVFFNAEDNSTSFGRAG
LGEYLAGYEGRLMRSLKSLLGSSLLDGKTEVQGRALHFRDLLAQFIGELKRRADRQAGGE
FEQAVLGRPVFFVDDDSDADRLAENTLGDIARAVGFKEVSFQYEPIAAAYHYETTLAREE
LVLVADIGGGTSDFSLIRLSPERARQAERRDDLLANGGVHIGGTDFDRLLSLAGVMPLLG
YRSLLRSGREMPASIFFNLATWHTINFAYTRQVLAEQQRLAMDAAAPEKMQRLLGLIGER
AGHWLANEVEQAKIALSDADTCTLSLERLEAGLSHELSRSEFDQATTSLVERVEGTVSDL
LRQAGVDAGRIDTVFFTGGSSGIPRLRQRIAAVLPQARAVEGDLFGSIGAGLAVEAARRY
G