Protein Info for Dsui_2735 in Dechlorosoma suillum PS

Annotation: glycine cleavage system T protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 TIGR00528: glycine cleavage system T protein" amino acids 3 to 357 (355 residues), 412 bits, see alignment E=9.7e-128 PF01571: GCV_T" amino acids 8 to 263 (256 residues), 246.8 bits, see alignment E=2e-77 PF08669: GCV_T_C" amino acids 283 to 355 (73 residues), 59.2 bits, see alignment E=3.1e-20

Best Hits

Swiss-Prot: 74% identical to GCST_DECAR: Aminomethyltransferase (gcvT) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K00605, aminomethyltransferase [EC: 2.1.2.10] (inferred from 74% identity to dar:Daro_2463)

Predicted SEED Role

"Aminomethyltransferase (glycine cleavage system T protein) (EC 2.1.2.10)" in subsystem Glycine and Serine Utilization or Glycine cleavage system or Photorespiration (oxidative C2 cycle) (EC 2.1.2.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPX5 at UniProt or InterPro

Protein Sequence (363 amino acids)

>Dsui_2735 glycine cleavage system T protein (Dechlorosoma suillum PS)
MTKQTVLNKAHRALNARMVDFGGWDMPVNYGSQIEEHHAVRNDCGMFDVSHMCAVDVTGA
DAKAFLLRLIANNVDKLKVPGKALYSAMLNEAGGVVDDLIVYYLTDTHYRVVINAGTADK
DLAWMDQLLGQWQLDVSVIPLREGPKAVAMIAVQGPQAKAKVWQVLPEVKAATKNLAPFF
GTQIGQFFIATTGYTGEDGFEIALPAAKAEDFWNALIAAGVRPCGLGARDTLRLEAGMNL
YGQDMDETVSPLDAGLAWTVDLKSERDFVGKSALLANGQKAQFLGLKLLDKGVLRAHQKV
VTSQGEGEITSGTFSPTLEQSIALARLPLGVAIGDTVQVDIRGKLLNAQVVKPVFARHGK
AVA