Protein Info for Dsui_2709 in Dechlorosoma suillum PS

Annotation: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 PF14805: THDPS_N_2" amino acids 3 to 69 (67 residues), 98.1 bits, see alignment E=4e-32 TIGR00965: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase" amino acids 4 to 271 (268 residues), 477.1 bits, see alignment E=8.4e-148 PF14602: Hexapep_2" amino acids 175 to 209 (35 residues), 53.9 bits, see alignment 1.8e-18 PF00132: Hexapep" amino acids 175 to 209 (35 residues), 33.7 bits, see alignment 3e-12

Best Hits

Swiss-Prot: 79% identical to DAPD_BURM1: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (dapD) from Burkholderia multivorans (strain ATCC 17616 / 249)

KEGG orthology group: K00674, 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase [EC: 2.3.1.117] (inferred from 82% identity to app:CAP2UW1_3636)

MetaCyc: 75% identical to tetrahydrodipicolinate succinylase (Escherichia coli K-12 substr. MG1655)
2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase. [EC: 2.3.1.117]

Predicted SEED Role

"2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (EC 2.3.1.117)" in subsystem Lysine Biosynthesis DAP Pathway (EC 2.3.1.117)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.117

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPF8 at UniProt or InterPro

Protein Sequence (272 amino acids)

>Dsui_2709 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (Dechlorosoma suillum PS)
MQELQQIIEDAWENRTSLQPGTAPAKIGEAVDHVLEQLDKGTLRVAEKINGDWVTHQWIK
KAVLLSFRLQDNVLQQSGDLRFFDKVQTKFANYDEHAFRQGGFRVVPPAVARRGSYIAKG
AVLMPSYVNIGAYVDENTMVDTWVTVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTIIED
NCFIGARSEVVEGVIVGEGSVISMGVYISQSTKIYDRETGEISYGRIPPGSVVVSGNLPA
KDGSHSLYCAVIVKKVDAQTRAKTSINELLRD