Protein Info for Dsui_2706 in Dechlorosoma suillum PS
Annotation: adenine phosphoribosyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 62% identical to APT_RHOFT: Adenine phosphoribosyltransferase (apt) from Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
KEGG orthology group: K00759, adenine phosphoribosyltransferase [EC: 2.4.2.7] (inferred from 62% identity to rfr:Rfer_4239)MetaCyc: 51% identical to adenine phosphoribosyltransferase (Sinorhizobium meliloti 1021)
Adenine phosphoribosyltransferase. [EC: 2.4.2.7]
Predicted SEED Role
"Adenine phosphoribosyltransferase (EC 2.4.2.7)" in subsystem Purine conversions or cAMP signaling in bacteria (EC 2.4.2.7)
MetaCyc Pathways
- superpathway of purine nucleotide salvage (13/14 steps found)
- adenine and adenosine salvage I (2/2 steps found)
- adenine salvage (2/3 steps found)
- adenine and adenosine salvage II (1/2 steps found)
- guanine and guanosine salvage I (1/2 steps found)
- guanine and guanosine salvage II (1/2 steps found)
- superpathway of guanine and guanosine salvage (1/3 steps found)
- glyphosate degradation III (2/7 steps found)
- (aminomethyl)phosphonate degradation (2/8 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.4.2.7
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See G8QPF5 at UniProt or InterPro
Protein Sequence (175 amino acids)
>Dsui_2706 adenine phosphoribosyltransferase (Dechlorosoma suillum PS) MNDAFFASHIRTIADWPQPGVQFRDITPLLRDGAAFRRLIDAFAERYADSHIDAVVGIDA RGFIIGAALAYRLGCGFIPVRKAGKLPFTTMQESYALEYGEASIEVHTDAALPGEHVLII DDLIATGGTLLAAVNLMTRLGARIIEAAAVVDLPELGGSARLAEAGLPTFTLLRY