Protein Info for Dsui_2666 in Dechlorosoma suillum PS

Annotation: putative transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 147 PF01638: HxlR" amino acids 42 to 127 (86 residues), 96.9 bits, see alignment E=2.6e-32

Best Hits

Swiss-Prot: 66% identical to YTFH_ECOLI: Uncharacterized HTH-type transcriptional regulator YtfH (ytfH) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 77% identity to mep:MPQ_0569)

Predicted SEED Role

"Redox-sensing transcriptional regulator QorR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPB5 at UniProt or InterPro

Protein Sequence (147 amino acids)

>Dsui_2666 putative transcriptional regulator (Dechlorosoma suillum PS)
MPSSPLAVPAPTPAETPTLAELMRRGDVFSDRCPSREVLQHVTSRWGVLVLVALLEGTHR
FSDLRRKVAGVSERMLAQTLQWLEADGLVRRQAFPVVPPHVEYSLTGLGREAGARVQALA
DWIEGNLADILAARETVQRDKSANRPK